Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Interferon alpha-inducible protein 6(IFI6)

Recombinant Human Interferon alpha-inducible protein 6(IFI6)

SKU:CSB-YP011016HU-GB

Regular price €759,95 EUR
Regular price Sale price €759,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 22-32 working days

Research Topic: Metabolism

Uniprot ID: P09912

Gene Names: IFI6

Organism: Homo sapiens (Human)

AA Sequence: GKKKCSESSDSGSGFWKALTFMAVGGGLAVAGLPALGFTGAGIAANSVAASLMSWSAILNGGGVPAGGLVATLQSLGAGGSSVVIGNIGALMGYATHKYLDSEEDEE

Expression Region: 24-130aa

Sequence Info: Full Length

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

MW: 12.4 kDa

Alternative Name(s): Interferon-induced protein 6-16 ;Ifi-6-16

Relevance:

Reference: Characterization of a human gene inducible by alpha- and beta-interferons and its expression in mouse cells.Kelly J.M., Porter A.C.G., Chernajovsky Y., Gilbert C.S., Stark G.R., Kerr I.M.EMBO J. 5:1601-1606(1986)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details