
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Cardiovascular
Uniprot ID: P08514
Gene Names: ITGA2B
Organism: Homo sapiens (Human)
AA Sequence: CVPQLQLTASVTGSPLLVGADNVLELQMDAANEGEGAYEAELAVHLPQGAHYMRALSNVEGFERLICNQKKENETRVVLCELGNPMKKNAQIGIAMLVSVGNLEEAGESVSFQLQIRSKNSQNPNSKIVLLDVPVRAEAQVELRGNSFPASLVVAAEEGEREQNSLDSWGPKVEHTYELHNNGPGTVNGLHLSIHLPGQSQPSDLLYILDIQPQGGLQCFPQPPVNPLKVDWGLPIPSPSPIHPAHHKR
Expression Region: 639-887aa
Sequence Info: Partial
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
MW: 43 kDa
Alternative Name(s): GPalpha IIb ;GPIIbPlatelet membrane glycoprotein IIb; CD41
Relevance: Integrin alpha-IIb/beta-3 is a receptor for fibronectin, fibrinogen, plasminogen, prothrombin, thrombospondin and vitronectin. It recognizes the sequence R-G-D in a wide array of ligands. It recognizes the sequence H-H-L-G-G-G-A-K-Q-A-G-D-V in fibrinogen gamma chain. Following activation integrin alpha-IIb/beta-3 brings about platelet/platelet interaction through binding of soluble fibrinogen. This step leads to rapid platelet aggregation which physically plugs ruptured endothelial cell surface.
Reference: Heterozygous ITGA2B R995W mutation inducing constitutive activation of the alphaIIbbeta3 receptor affects proplatelet formation and causes congenital macrothrombocytopenia.Kunishima S., Kashiwagi H., Otsu M., Takayama N., Eto K., Onodera M., Miyajima Y., Takamatsu Y., Suzumiya J., Matsubara K., Tomiyama Y., Saito H.Blood 117:5479-5484(2011)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Human Integrin alpha-IIb(ITGA2B),partial
- Regular price
- €685,95 EUR
- Sale price
- €685,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Integrin alpha-2(ITGA2),partial
- Regular price
- €685,95 EUR
- Sale price
- €685,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Integrin alpha-2(ITGA2) ,partial
- Regular price
- €613,95 EUR
- Sale price
- €613,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Platelet glycoprotein Ib alpha chain(GP1BA),partial
- Regular price
- €685,95 EUR
- Sale price
- €685,95 EUR
- Regular price
-
- Unit price
- per
Sold out