Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Immunoglobulin lambda-like polypeptide 5(IGLL5)

Recombinant Human Immunoglobulin lambda-like polypeptide 5(IGLL5)

SKU:CSB-YP494948HU

Regular price €684,95 EUR
Regular price Sale price €684,95 EUR
Sale Sold out
Shipping calculated at checkout.
 More payment options

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 22-32 working days

Research Topic: Immunology

Uniprot ID: B9A064

Gene Names: IGLL5

Organism: Homo sapiens (Human)

AA Sequence: HGLLRPMVAPQSGDPDPGASVGSSRSSLRSLWGRLLLQPSPQRADPRCWPRGFWSEPQSLCYVFGTGTKVTVLGQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS

Expression Region: 36-214aa

Sequence Info: Full Length

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

MW: 21.3 kDa

Alternative Name(s): G lambda-1 Germline immunoglobulin lambda 1

Relevance:

Reference: "Proteomic analyses reveal distinct chromatin-associated and soluble transcription factor complexes."Li X., Wang W., Wang J., Malovannaya A., Xi Y., Li W., Guerra R., Hawke D.H., Qin J., Chen J.Mol. Syst. Biol. 11:775-775(2015)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)