Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human HLA-C protein(HLA-C),partial

Recombinant Human HLA-C protein(HLA-C),partial

SKU:CSB-RP150994h

Regular price €606,95 EUR
Regular price Sale price €606,95 EUR
Sale Sold out
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170725

Research areas: Immunology

Target / Protein: HLA-C

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Homo sapiens (Human)

Delivery time: 3-7 business days

Uniprot ID: O78179

AA Sequence: CSHSMRYFYTAVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQTDRVSLRNLRGYYNQSEAGSHTLQWMYGCDLGPDGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAARAAEQQRAYLEGTCVEWLRRYLENGKETLQRAEHPKTHVTHHLVSDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLTLRWEPSSQPTIPI

Tag info: N-terminal 6xHis-tagged

Expression Region: 25-308aa

Protein length: Partial

MW: 36.7 kDa

Alternative Name(s):

Relevance: Involved in the presentation of foreign antigens to the immune syst.SAAS annotation

Reference: "HLA-C(*)03 is a risk factor for cardiomyopathy in Chagas disease."Layrisse Z., Fernandez M.T., Montagnani S., Matos M., Balbas O., Herrera F., Colorado I.A., Catalioti F., Acquatella H.Hum. Immunol. 61:925-929(2000)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details