Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Guanylate kinase(GUK1)

Recombinant Human Guanylate kinase(GUK1)

SKU:CSB-EP619089HU

Regular price €606,95 EUR
Regular price Sale price €606,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Cancer

Uniprot ID: Q16774

Gene Names: GUK1

Organism: Homo sapiens (Human)

AA Sequence: SGPRPVVLSGPSGAGKSTLLKRLLQEHSGIFGFSVSHTTRNPRPGEENGKDYYFVTREVMQRDIAAGDFIEHAEFSGNLYGTSKVAVQAVQAMNRICVLDVDLQGVRNIKATDLRPIYISVQPPSLHVLEQRLRQRNTETEESLVKRLAAAQADMESSKEPGLFDVVIINDSLDQAYAELKEALSEEIKKAQRTGA

Expression Region: 2-197aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 37.6 kDa

Alternative Name(s): GMP kinase

Relevance: Essential for recycling GMP and indirectly, cGMP.

Reference: "Human guanylate kinase (GUK1): cDNA sequence, expression and chromosomal localisation."Fitzgibbon J., Katsanis N., Wells D., Delhanty J., Vallins W., Hunt D.M.FEBS Lett. 385:185-188(1996)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details