Recombinant Human Growth/differentiation factor 8 (MSTN) (Active)

SKU: O14793

Size: 100ug. Other sizes are also available.

Activity: Yes

Research Areas: Signal Transduction

Uniprot ID: O14793

Gene Names: MSTN

Alternative Name(s): Growth/differentiation factor 8; GDF-8; Myostatin; MSTN; GDF8

Abbreviation: Recombinant Human MSTN protein (Active)

Organism: Homo sapiens (Human)

Source: Mammalian cell

Expression Region: 24-375aa

Protein Length: Full Length

Tag Info: N-terminal 10xHis-tagged

Target Protein Sequence: NENSEQKENVEKEGLCNACTWRQNTKSSRIEAIKIQILSKLRLETAPNISKDVIRQLLPKAPPLRELIDQYDVQRDDSSDGSLEDDDYHATTETIITMPTESDFLMQVDGKPKCCFFKFSSKIQYNKVVKAQLWIYLRPVETPTTVFVQILRLIKPMKDGTRYTGIRSLKLDMNPGTGIWQSIDVKTVLQNWLKQPESNLGIEIKALDENGHDLAVTFPGPGEDGLNPFLEVKVTDTPKRSRRDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS

MW: 42.2 kDa

Purity: Greater than 95% as determined by SDS-PAGE.

Endotoxin: Less than 1.0 EU/μg as determined by LAL method.

Biological_Activity: Measured by its binding ability in a functional ELISA. Immobilized Human MSTN(GDF-8) at 2 μg/mL can bind Human ACVR2B (CSB-MP623829HUi9). The EC50 is 68.26-74.59 ng/mL.

Form: Lyophilized powder

Buffer: Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Acts specifically as a negative regulator of skeletal muscle growth.

Reference: Myostatin and the Heart. Knapp M., Supruniuk E., Gorski J. Biomolecules 13: 1777-1777 (2023)

Function: