Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Glycodelin(PAEP)

Recombinant Human Glycodelin(PAEP)

SKU:CSB-MP017381HU

Regular price €584,95 EUR
Regular price Sale price €584,95 EUR
Sale Sold out
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 20ug

Updated Date: Stock Protein updated on 20171018

Research areas: Tags & Cell Markers

Target / Protein: PAEP

Biologically active: Not Tested

Expression system: Mammalian cell

Species of origin: Homo sapiens (Human)

Delivery time: 3-7 business days

Uniprot ID: P09466

AA Sequence: MDIPQTKQDLELPKLAGTWHSMAMATNNISLMATLKAPLRVHITSLLPTPEDNLEIVLHRWENNSCVEKKVLGEKTENPKKFKINYTVANEATLLDTDYDNFLFLCLQDTTTPIQSMMCQYLARVLVEDDEIMQGFIRAFRPLPRHLWYLLDLKQMEEPCRF

Tag info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Expression Region: 19-180aa

Protein length: Full Length of Mature Protein

MW: 23,9

Alternative Name(s): Placental protein 14 Short name:PP14

Relevance: This protein is, quantitatively, the main protein synthe>Several Other Sizes Are Also Available. Please Inquire. Default Sized and secreted in the endometrium from mid-luteal phase of the menstrual cycle and during the first semester of pregnancy.

Reference: "Multiple forms of mRNA encoding human pregnancy-associated endometrial alpha 2-globulin, a beta-lactoglobulin homologue."Garde J., Bell S.C., Eperon I.C.Proc. Natl. Acad. Sci. U.S.A. 88:2456-2460(1991)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details