
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Cancer
Uniprot ID: P48060
Gene Names: GLIPR1
Organism: Homo sapiens (Human)
AA Sequence: ANILPDIENEDFIKDCVRIHNKFRSEVKPTASDMLYMTWDPALAQIAKAWASNCQFSHNTRLKPPHKLHPNFTSLGENIWTGSVPIFSVSSAITNWYDEIQDYDFKTRICKKVCGHYTQVVWADSYKVGCAVQFCPKVSGFDALSNGAHFICNYGPGGNYPTWPYKRGATCSACPNNDKCLDNLCVNRQRDQVKRYYSVVYPGWPIYPRNR
Expression Region: 22-232aa
Sequence Info: Partial
Source: E.coli
Tag Info: N-terminal 6xHis-tagged
MW: 28.1 kDa
Alternative Name(s): Protein RTVP-1
Relevance:
Reference: The human glioma pathogenesis-related protein is structurally related to plant pathogenesis-related proteins and its gene is expressed specifically in brain tumors.Murphy E.V., Zhang Y., Zhu W., Biggs J.Gene 159:131-135(1995)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Mouse Glioma pathogenesis-related protein 1(Glipr1)
- Regular price
- €1.368,95 EUR
- Sale price
- €1.368,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Zinc finger protein GLI1(GLI1),partial
- Regular price
- €611,95 EUR
- Sale price
- €611,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Matrix Gla protein(MGP)
- Regular price
- €801,95 EUR
- Sale price
- €801,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Matrix Gla protein(MGP)
- Regular price
- €611,95 EUR
- Sale price
- €611,95 EUR
- Regular price
-
- Unit price
- per
Sold out