Recombinant Human Gastrokine-1 (GKN1), partial

SKU: Q9NS71

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Others

Uniprot ID: Q9NS71

Gene Names: GKN1

Alternative Name(s): (18 kDa antrum mucosa protein)(AMP-18)(Protein CA11)

Abbreviation: Recombinant Human GKN1 protein, partial

Organism: Homo sapiens (Human)

Source: Yeast

Expression Region: 35-199aa

Protein Length: Partial

Tag Info: C-terminal 6xHis-tagged

Target Protein Sequence: NYNINVNDDNNNAGSGQQSVSVNNEHNVANVDNNNGWDSWNSIWDYGNGFAATRLFQKKTCIVHKMNKEVMPSIQSLDALVKEKKLQGKGPGGPPPKGLMYSVNPNKVDDLSKFGKNIANMCRGIPTYMAEEMQEASLFFYSGTCYTTSVLWIVDISFCGDTVEN

MW: 19.8 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Has mitogenic activity and may be involved in maintaining the integrity of the gastric mucosal epithelium.

Reference: "A novel mitogenic protein that is highly expressed in cells of the gastric antrum mucosa." Martin T.E., Powell C.T., Wang Z., Bhattacharyya S., Walsh-Reitz M.M., Agarwal K., Toback F.G. Am. J. Physiol. 285: G332-G343(2003)

Function: