Skip to product information
1 of 1

GeneBio Systems

Recombinant Human Gastric inhibitory polypeptide receptor (GIPR), partial (Active)

Recombinant Human Gastric inhibitory polypeptide receptor (GIPR), partial (Active)

SKU:P48546

Regular price €397,95 EUR
Regular price Sale price €397,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Yes

Research Areas: Obesity

Uniprot ID: P48546

Gene Names: GIPR

Alternative Name(s):

Abbreviation: Recombinant Human GIPR protein, partial (Active)

Organism: Homo sapiens (Human)

Source: Mammalian cell

Expression Region: 22-138aa

Protein Length: Partial

Tag Info: C-terminal 10xHis-tagged

Target Protein Sequence: RAETGSKGQTAGELYQRWERYRRECQETLAAAEPPSGLACNGSFDMYVCWDYAAPNATARASCPWYLPWHHHVAAGFVLRQCGSDGQWGLWRDHTQCENPEKNEAFLDQRLILERLQ

MW: 16.2 kDa

Purity: Greater than 95% as determined by SDS-PAGE.

Endotoxin: Less than 1.0 EU/μg as determined by LAL method.

Biological_Activity: Measured by its binding ability in a functional ELISA. Immobilized Human GIPR at 2 μg/mL can bind Anti-GIPR recombinant antibody ( CSB-RA009438MA1HU). The EC50 is 16.18-18.70 ng/mL.

Form: Lyophilized powder

Buffer: Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: This is a receptor for GIP. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase.

Reference: "The human GIP receptor: gene structure, functional expression of its cDNA, and chromosomal location." Usdin T.B., Gruber C., Modi W., Bonner T.I. Submitted to EMBL/GenBank/DDBJ databases (OCT-1995)

Function:

View full details