Recombinant Human Fibronectin type 3 and ankyrin repeat domains protein 1(FANK1)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Human Fibronectin type 3 and ankyrin repeat domains protein 1(FANK1)

CSB-EP819458HU
Regular price
€609,95 EUR
Sale price
€609,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Developmental Biology

Uniprot ID: Q8TC84

Gene Names: FANK1

Organism: Homo sapiens (Human)

AA Sequence: MEPQKIMPPSKPHPPVVGKVTHHSIELYWDLEKKAKRQGPQEQWFRFSIEEEDPKMHTYGIIYTGYATKHVVEGLEPRTLYRFRLKVTSPSGECEYSPLVSVSTTREPISSEHLHRAVSVNDEDLLVRILQGGRVKVDVPNKFGFTALMVAAQKGYTRLVKILVSNGTDVNLKNGSGKDSLMLACYAGHLDVVKYLRRHGASWQARDLGGCTALHWAADGGHCSVIEWMIKDGCEVDVVDTGSGWTPLMRVSAVSGNQRVASLLIDAGANVNVKDRNGKTPLMVAVLNNHEELVQLLLDKGADASVKNEFGKGVLEMARVFDRQSVVSLLEERKKKQRPKKSCVC

Expression Region: 1-345aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 54.3 kDa

Alternative Name(s):

Relevance:

Reference: A new spermatogenesis-related gene.Hu T.H., Miao S.Y., Zhang X.D., Qiao Y., Liang G., Wang L.F. Fank1 is a testis-specific gene encoding a nuclear protein exclusively expressed during the transition from the meiotic to the haploid phase of spermatogenesis.Zheng Z., Zheng H., Yan W.Gene Expr. Patterns 7:777-783(2007)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

You may also like

  • Recombinant Human AN1-type zinc finger protein 3(ZFAND3)
    Regular price
    €609,95 EUR
    Sale price
    €609,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human N-myc proto-oncogene protein(MYCN)
    Regular price
    €680,95 EUR
    Sale price
    €680,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Biglycan(BGN)
    Regular price
    €609,95 EUR
    Sale price
    €609,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human PDZ and LIM domain protein 1(PDLIM1)
    Regular price
    €609,95 EUR
    Sale price
    €609,95 EUR
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share