Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Epididymal secretory glutathione peroxidase(GPX5)

Recombinant Human Epididymal secretory glutathione peroxidase(GPX5)

SKU:CSB-EP009870HU

Regular price €865,95 EUR
Regular price Sale price €865,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Signal Transduction

Uniprot ID: O75715

Gene Names: GPX5

Organism: Homo sapiens (Human)

AA Sequence: MTTQLRVVHLLPLLLACFVQTSPKQEKMKMDCHKDEKGTIYDYEAIALNKNEYVSFKQYVGKHILFVNVATYCGLTAQYPGMSVQGEDLYLVSSFLRKGM

Expression Region: 1-100aa

Sequence Info: Full Length of Isoform 2

Source: E.coli

Tag Info: N-terminal 6xHis-Trx-tagged

MW: 28.4 kDa

Alternative Name(s): Epididymis-specific glutathione peroxidase-like protein

Relevance: Protects cells and enzymes from oxidative damage, by catalyzing the reduction of hydrogen peroxide, lipid peroxides and organic hydroperoxide, by glutathione. May constitute a glutathione peroxidase-like protective system against peroxide damage in sperm membrane lipids.

Reference: "The majority of human glutathione peroxidase type 5 (GPX5) transcripts are incorrectly spliced: implications for the role of GPX5 in the male reproductive tract." Hall L., Williams K., Perry A.C.F., Frayne J., Jury J.A. Biochem. J. 333:5-9(1998)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details