Gene Bio Systems
Recombinant Human Ephrin-B1(EFNB1)
Recombinant Human Ephrin-B1(EFNB1)
SKU:CSB-CF007465HU
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Homo sapiens (Human)
Uniprot NO.:P98172
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:LAKNLEPVSWSSLNPKFLSGKGLVIYPKIGDKLDIICPRAEAGRPYEYYKLYLVRPEQAAACSTVLDPNVLVTCNRPEQEIRFTIKFQEFSPNYMGLEFKKHHDYYITSTSNGSLEGLENREGGVCRTRTMKIIMKVGQDPNAVTPEQLTTSRPSKEADNTVKMATQAPGSRGSLGDSDGKHETVNQEEKSGPGASGGSSGDPDGFFNSKVALFAAVGAGCVIFLLIIIFLTVLLLKLRKRHRKHTQQRAAALSLSTLASPKGGSGTAGTEPSDIIIPLRTTENNYCPHYEKVSGDYGHPVYIVQEMPPQSPANIYYKV
Protein Names:Recommended name: Ephrin-B1 Alternative name(s): EFL-3 ELK ligand Short name= ELK-L EPH-related receptor tyrosine kinase ligand 2 Short name= LERK-2
Gene Names:Name:EFNB1 Synonyms:EFL3, EPLG2, LERK2
Expression Region:28-346
Sequence Info:full length protein
