Gene Bio Systems
Recombinant Human E3 ubiquitin-protein ligase RNF5(RNF5)
Recombinant Human E3 ubiquitin-protein ligase RNF5(RNF5)
SKU:CSB-CF857879HU
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Homo sapiens (Human)
Uniprot NO.:Q99942
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:AAAEEEDGGPEGPNRERGGAGATFECNICLETAREAVVSVCGHLYCWPCLHQWLETRPER QECPVCKAGISREKVVPLYGRGSQKPQDPRLKTPPRPQGQRPAPESRGGFQPFGDTGGFH FSFGVGAFPFGFFTTVFNAHEPFRRGTGVDLGQGHPASSWQDSLFLFLAIFFFFWLLSI
Protein Names:Recommended name: E3 ubiquitin-protein ligase RNF5 EC= 6.3.2.- Alternative name(s): Protein G16 RING finger protein 5 Ram1 homolog Short name= HsRma1
Gene Names:Name:RNF5 Synonyms:G16, NG2, RMA1
Expression Region:2-180
Sequence Info:full length protein
