Recombinant Human cytomegalovirus Viral interleukin-10 homolog(UL111A)

Recombinant Human cytomegalovirus Viral interleukin-10 homolog(UL111A)

CSB-EP517245HWWe1
Regular price
€700,95 EUR
Sale price
€700,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20171018

Research areas: Others

Target / Protein: UL111A

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Human cytomegalovirus (strain Merlin) (HHV-5) (Human herpesvirus 5)

Delivery time: 3-7 business days

Uniprot ID: F5HC71

AA Sequence: ATTTTIKNTKPQCRPEDYATRLQDLRVTFHRVKPTLQREDDYSVWLDGTVVKGCWGCSVMDWLLRRYLEIVFPAGDHVYPGLKTELHSMRSTLESIYKDAMRQCPLLGCGDKSVISRLSQEAERKSDNGTRKGLSELDTLFSRLEEYLHSRK

Tag info: NO-tagged

Expression Region: 26-176aa

Protein length: Full Length of Mature Protein

MW: 17.5 kDa

Alternative Name(s):

Relevance: Functional viral IL-10 homolog. Can bind to the human IL-10 receptor and compete with human IL-10 for binding sites. Requires both subunits of the human IL-10 receptor complex to induce signal transduction events and biological activities. IL-10 signaling pathway has several immunosuppressive activities that are exploited by the virus. Inhibits TLR-induced type I interferon production in host plasmacytoid dendritic cells.

Reference: "Two novel spliced genes in human cytomegalovirus." Akter P., Cunningham C., McSharry B.P., Dolan A., Addison C., Dargan D.J., Hassan-Walker A.F., Emery V.C., Griffiths P.D., Wilkinson G.W., Davison A.J. J. Gen. Virol. 84:1117-1122(2003)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share