Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human cytomegalovirus Membrane glycoprotein UL9(UL9)

Recombinant Human cytomegalovirus Membrane glycoprotein UL9(UL9)

SKU:CSB-CF520534HWW

Regular price €1.496,95 EUR
Regular price Sale price €1.496,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Human cytomegalovirus (strain Merlin) (HHV-5) (Human herpesvirus 5)

Uniprot NO.:F5H9T4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:QYWNYMTIPCTPTVGYGSHNISLHPLNNSLFQDDVFEWYIDKPMVTNKLCLYQSNERIKS NLDSPNIMWQCTDNRTLILMNLTTTYSRNYYFQSFKYLGQGVPKPNNLCYNVSVHFTHQT HCHTTTSSLYPPTSVHDSLEISQSFTSTNFTHTAVHYAAGNVEAQHDTATSHTMWIIPLV IVITIIVLICFKFPQKAWNKFTQYRYSGMLAAA

Protein Names:Recommended name: Membrane glycoprotein UL9

Gene Names:Name:UL9

Expression Region:21-233

Sequence Info:full length protein

View full details