Recombinant Human cytomegalovirus Envelope glycoprotein L(gL)

Recombinant Human cytomegalovirus Envelope glycoprotein L(gL)

CSB-YP515269HWW
Regular price
€545,95 EUR
Sale price
€545,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 22-32 working days

Research Topic: Others

Uniprot ID: F5HCH8

Gene Names: gL

Organism: Human cytomegalovirus (strain Merlin) (HHV-5) (Human herpesvirus 5)

AA Sequence: AAVSVAPTAAEKVPAECPELTRRCLLGEVFEGDKYESWLRPLVNVTGRDGPLSQLIRYRPVTPEAANSVLLDEAFLDTLALLYNNPDQLRALLTLLSSDTAPRWMTVMRGYSECGDGSPAVYTCVDDLCRGYDLTRLSYGRSIFTEHVLGFELVPPSLFNVVVAIRNEATRTNRAVRLPVSTAAAPEGITLFYGLYNAVKEFCLRHQLDPPLLRHLDKYYAGLPPELKQTRVNLPAHSRYGPQAVDAR

Expression Region: 31-278aa

Sequence Info: Full Length

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

MW: 29.5 kDa

Alternative Name(s):

Relevance: The heterodimer glycoprotein H-glycoprotein L is required for the fusion of viral and plasma mbranes leading to virus entry into the host cell. Mbrane fusion is mediated by the fusion machinery composed at least of gB and the heterodimer gH/gL .

Reference: Genetic content of wild-type human cytomegalovirus.Dolan A., Cunningham C., Hector R.D., Hassan-Walker A.F., Lee L., Addison C., Dargan D.J., McGeoch D.J., Gatherer D., Emery V.C., Griffiths P.D., Sinzger C., McSharry B.P., Wilkinson G.W.G., Davison A.J.J. Gen. Virol. 85:1301-1312(2004)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share