Skip to product information
1 of 1

GeneBio Systems

Recombinant Human Cytokine receptor common subunit gamma (IL2RG), partial (Active)

Recombinant Human Cytokine receptor common subunit gamma (IL2RG), partial (Active)

SKU:P31785

Regular price €340,95 EUR
Regular price Sale price €340,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Yes

Research Areas: Immunology

Uniprot ID: P31785

Gene Names: IL2RG

Alternative Name(s): Interleukin-2 receptor subunit gamma (IL-2 receptor subunit gamma; IL-2R subunit gamma; IL-2RG); gammaC; p64; CD132

Abbreviation: Recombinant Human IL2RG protein, partial (Active)

Organism: Homo sapiens (Human)

Source: Mammalian cell

Expression Region: 23-254aa

Protein Length: Partial

Tag Info: C-terminal 10xHis-tagged

Target Protein Sequence: LNTTILTPNGNEDTTADFFLTTMPTDSLSVSTLPLPEVQCFVFNVEYMNCTWNSSSEPQPTNLTLHYWYKNSDNDKVQKCSHYLFSEEITSGCQLQKKEIHLYQTFVVQLQDPREPRRQATQMLKLQNLVIPWAPENLTLHKLSESQLELNWNNRFLNHCLEHLVQYRTDWDHSWTEQSVDYRHKFSLPSVDGQKRYTFRVRSRFNPLCGSAQHWSEWSHPIHWGSNTSKEN

MW: 28.8 kDa

Purity: Greater than 95% as determined by SDS-PAGE.

Endotoxin: Less than 1.0 EU/μg as determined by LAL method.

Biological_Activity: Measured by its binding ability in a functional ELISA. Immobilized Human IL2RG at 2 μg/mL can bind Anti-IL2RG recombinant antibody (CSB-RA011651MA1HU). The EC50 is 12.19-13.63 ng/mL.

Form: Lyophilized powder

Buffer: Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Common subunit for the receptors for a variety of interleukins. Probably in association with IL15RA, involved in the stimulation of neutrophil phagocytosis by IL15.

Reference: The DNA sequence of the human X chromosome. Ross M.T., Grafham D.V., Coffey A.J., Scherer S., McLay K., Muzny D., Platzer M., Howell G.R., Burrows C., Bentley D.R. Nature 434: 325-337 (2005)

Function:

View full details