
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Metabolism
Uniprot ID: P13073
Gene Names: COX4I1
Organism: Homo sapiens (Human)
AA Sequence: AHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQKALKEKEKASWSSLSMDEKVELYRIKFKESFAEMNRGSNEWKTVVGGAMFFIGFTALVIMWQKHYVYGPLPQSFDKEWVAKQTKRMLDMKVNPIQGLASKWDYEKNEWKK
Expression Region: 23-169aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
MW: 33.2 kDa
Alternative Name(s): Cytochrome c oxidase polypeptide IVCytochrome c oxidase subunit IV isoform 1 ;COX IV-1
Relevance: This protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport.
Reference: Isolation of a cDNA clone encoding subunit IV of human cytochrome c oxidase.Zeviani M., Nakagawa M., Herbert J., Lomax M.I., Grossman L.I., Sherbany A.A., Miranda A.F., Dimauro S., Schon E.A.Gene 55:205-217(1987)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Human Cytochrome c oxidase subunit 5A, mitochondrial(COX5A)
- Regular price
- €500,95 EUR
- Sale price
- €500,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Cytochrome c oxidase subunit 2(MT-CO2)
- Regular price
- €1.112,95 EUR
- Sale price
- €1.112,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human COX4I1
- Regular price
- €472,95 EUR
- Sale price
- €472,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Bovine Cytochrome c oxidase subunit 4 isoform 1, mitochondrial(COX4I1)
- Regular price
- €1.052,95 EUR
- Sale price
- €1.052,95 EUR
- Regular price
-
- Unit price
- per
Sold out