Recombinant Human Cytochrome b-c1 complex subunit 9(UQCR10)

Recombinant Human Cytochrome b-c1 complex subunit 9(UQCR10)

CSB-EP890670HU
Regular price
€628,95 EUR
Sale price
€628,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Tags & Cell Markers

Uniprot ID: Q9UDW1

Gene Names: UQCR10

Organism: Homo sapiens (Human)

AA Sequence: AAATLTSKLYSLLFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLWKHIKHKYENK

Expression Region: 1-63aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal GST-tagged

MW: 34.2 kDa

Alternative Name(s): Complex III subunit 9 Complex III subunit X Cytochrome c1 non-heme 7KDA protein Ubiquinol-cytochrome c reductase complex 7.2KDA protein

Relevance: This is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain. This subunit interacts with cytochrome c1

Reference: "Ubiquinol-cytochrome-c reductase from human and bovine mitochondria." Schaegger H., Brandt U., Gencic S., von Jagow G. Methods Enzymol. 260:82-96(1995)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share