Recombinant Human/Cynomolgus monkey Activin receptor type-2A (ACVR2A), partial (Active)

SKU: P27037

Size: 100ug. Other sizes are also available.

Activity: Yes

Research Areas: Signal Transduction

Uniprot ID: P27037

Gene Names: ACVR2A

Alternative Name(s): Activin receptor type-2A; EC: 2.7.11.30; Activin receptor type IIA (ACTR-IIA; ACTRIIA);ACVR2A; ACVR2

Abbreviation: Recombinant Human/Cynomolgus monkey ACVR2A protein, partial (Active)

Organism: Homo sapiens (Human)

Source: Yeast

Expression Region: 20-135aa

Protein Length: Partial

Tag Info: C-terminal 10xHis-tagged

Target Protein Sequence: AILGRSETQECLFFNANWEKDRTNQTGVEPCYGDKDKRRHCFATWKNISGSIEIVKQGCWLDDINCYDRTDCVEKKDSPEVYFCCCEGNMCNEKFSYFPEMEVTQPTSNPVTPKPP

MW: 15.5 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Endotoxin: Less than 1.0 EU/μg as determined by LAL method.

Biological_Activity: Measured by its binding ability in a functional ELISA. Immobilized Human ACVR2A at 2 μg/mL can bind Anti-ACVR2A&ACVR2B recombinant antibody (CSB-RA623829MA1HU). The EC50 is 5.139-5.959 ng/mL.

Form: Lyophilized powder

Buffer: Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: On ligand binding, forms a receptor complex consisting of two type II and two type I transmembrane serine/threonine kinases. Type II receptors phosphorylate and activate type I receptors which autophosphorylate, then bind and activate SMAD transcriptional regulators. Receptor for activin A, activin B and inhibin A. Mediates induction of adipogenesis by GDF6.

Reference: Activin a Receptor Type 2A Mutation Affects the Tumor Biology of Microsatellite Instability-High Gastric Cancer. Yuza K., Nagahashi M., Ichikawa H., Hanyu T., Nakajima M., Shimada Y., Ishikawa T., Sakata J., Takeuchi S., Wakai T. J Gastrointest Surg 25: 2231-2241 (2021)

Function: