Gene Bio Systems
Recombinant Human Connective tissue growth factor(CTGF),partial
Recombinant Human Connective tissue growth factor(CTGF),partial
SKU:CSB-RP094244h
Couldn't load pickup availability
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Immunology
Uniprot ID: P29279
Gene Names: CTGF
Organism: Homo sapiens (Human)
AA Sequence: GKKCIRTPKISKPIKFELSGCTSMKTYRAKFCGVCTDGRCCTPHRTTTLPVEFKCPDGEVMKKNMMFIKTCACHYNCPGDNDIFESLYYRKMYGDMA
Expression Region: 253-349aa
Sequence Info: Partial
Source: E.coli
Tag Info: N-terminal GST-tagged
MW: 38.1 kDa
Alternative Name(s): CCN family member 2Hypertrophic chondrocyte-specific protein 24Insulin-like growth factor-binding protein 8 ;IBP-8 ;IGF-binding protein 8 ;IGFBP-8
Relevance: Major connective tissue mitoattractant secreted by vascular endothelial cells. Promotes proliferation and differentiation of chondrocytes. Mediates heparin- and divalent cation-dependent cell adhesion in many cell types including fibroblasts, myofibroblasts, endothelial and epithelial cells. Enhances fibroblast growth factor-induced DNA synthesis.
Reference: Connective tissue growth factor a cysteine-rich mitogen secreted by human vascular endothelial cells is related to the SRC-induced immediate early gene product CEF-10.Bradham D.M., Igarashi A., Potter R.L., Grotendorst G.R.J. Cell Biol. 114:1285-1294(1991)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
