GeneBio Systems
Recombinant Human Collagen alpha-1 (XVIII) chain (COL18A1), partial
Recombinant Human Collagen alpha-1 (XVIII) chain (COL18A1), partial
SKU:P39060
Couldn't load pickup availability
Size: 100ug. Other sizes are also available.
Activity: Not tested
Research Areas: Cell Adhesion
Uniprot ID: P39060
Gene Names: COL18A1
Alternative Name(s):
Abbreviation: Recombinant Human COL18A1 protein, partial
Organism: Homo sapiens (Human)
Source: Yeast
Expression Region: 24-200aa
Protein Length: Partial
Tag Info: N-terminal 6xHis-tagged
Target Protein Sequence: NLLNLNWLWFNNEDTSHAATTIPEPQGPLPVQPTADTTTHVTPRNGSTEPATAPGSPEPPSELLEDGQDTPTSAESPDAPEENIAGVGAEILNVAKGIRSFVQLWNDTVPTESLARAETLVLETPVGPLALAGPSSTPQENGTTLWPSRGIPSSPGAHTTEAGTLPAPTPSPPSLGR
MW: 19.8 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Endotoxin: Not test
Biological_Activity:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: COLA18A probably plays a major role in determining the retinal structure as well as in the closure of the neural tube.Endostatin potently inhibits endothelial cell proliferation and angiogenesis. May inhibit angiogenesis by binding to the heparan sulfate proteoglycans involved in growth factor signaling.
Reference:
Function:
