Skip to product information
1 of 1

GeneBio Systems

Recombinant Human Claudin-6 (CLDN6), Fluorescent-VLPs (Active)

Recombinant Human Claudin-6 (CLDN6), Fluorescent-VLPs (Active)

SKU:P56747

Regular price €1.295,95 EUR
Regular price Sale price €1.295,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Yes

Research Areas: Cancer

Uniprot ID: P56747

Gene Names: CLDN6

Alternative Name(s): UNQ757;PRO1488

Abbreviation: Recombinant Human CLDN6 protein, Fluorescent-VLPs (Active)

Organism: Homo sapiens (Human)

Source: Mammalian cell

Expression Region: 1-220aa

Protein Length: Full Length

Tag Info: C-terminal EGFP-tagged

Target Protein Sequence: MASAGMQILGVVLTLLGWVNGLVSCALPMWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVIALLVALFGLLVYLAGAKCTTCVEEKDSKARLVLTSGIVFVISGVLTLIPVCWTAHAIIRDFYNPLVAEAQKRELGASLYLGWAASGLLLLGGGLLCCTCPSGGSQGPSHYMARYSTSAPAISRGPSEYPTKNYV

MW: 50.5 kDa

Purity: The purity information is not available for VLPs proteins.

Endotoxin: Less than 1.0 EU/μg as determined by LAL method.

Biological_Activity: Measured by its binding ability in a functional ELISA. Immobilized Human CLDN6 at 10 μg/mL can bind Anti-CLDN6/9 recombinant antibody (CSB-RA005508MA1HU), the EC50 is 0.5574-0.7361 ng/mL.

Form: Lyophilized powder

Buffer: Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80℃. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: The VLPs are expressed from human 293 cells (HEK293).Mix the sample gently by repeatedly pipetting it up and down. Do not vortex.Repeated freezing and thawing is not recommended.Store the protein at -20℃/-80℃ upon receiving it, and ensure to avoid repeated freezing and thawing, otherwise, it will affect the protein activity. The immunization strategy should be optimized (antigen dose, regimen and adjuvant).

Relevance: Plays a major role in tight junction-specific obliteration of the intercellular space. (Microbial infection) Acts as a receptor for hepatitis C virus (HCV) entry into hepatic cells.

Reference: "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment." Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J., Chen J., Chow B., Chui C., Gray A.M. Genome Res. 13: 2265-2270 (2003) "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Sugano S. Nat. Genet. 36: 40-45 (2004)

Function:

View full details