Gene Bio Systems
Recombinant Human Carcinoembryonic antigen-related cell adhesion molecule 8(CEACAM8)
Recombinant Human Carcinoembryonic antigen-related cell adhesion molecule 8(CEACAM8)
SKU:CSB-EP005168HU
Couldn't load pickup availability
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: Yes
Lead time: 3-7 working days
Research Topic: Immunology
Uniprot ID: P31997
Gene Names: CEACAM8
Organism: Homo sapiens (Human)
AA Sequence: QLTIEAVPSNAAEGKEVLLLVHNLPQDPRGYNWYKGETVDANRRIIGYVISNQQITPGPAYSNRETIYPNASLLMRNVTRNDTGSYTLQVIKLNLMSEEVTGQFSVHPETPKPSISSNNSNPVEDKDAVAFTCEPETQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLLSVTRNDVGPYECEIQNPASANFSDPVTLNVLYGPDAPTISPSDTYYHAGVNLNLSCHAASNPPSQYSWSVNGTFQQYTQKLFIPNITTKNSGSYACHTTNSATGRNRTTVRMITVSD
Expression Region: 35-320aa
Sequence Info: Full Length of Mature Protein
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
MW: 47.5 kDa
Alternative Name(s): CD67 antigen Carcinoembryonic antigen CGM6 Non-specific cross-reacting antigen NCA-95 CD_antigen: CD66b
Relevance:
Reference: "High expression of CEACAM6 and CEACAM8 mRNA in acute lymphoblastic leukemias." Lasa A., Serrano E., Carricondo M., Carnicer M.J., Brunet S., Badell I., Sierra J., Aventin A., Nomdedeu J.F. Ann. Hematol. 87:205-211(2008)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
