Skip to product information
1 of 1

GeneBio Systems

Recombinant Human Carboxypeptidase N catalytic chain (CPN1), partial

Recombinant Human Carboxypeptidase N catalytic chain (CPN1), partial

SKU:P15169

Regular price €677,95 EUR
Regular price Sale price €677,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Signal Transduction

Uniprot ID: P15169

Gene Names: CPN1

Alternative Name(s): Anaphylatoxin inactivator (Arginine carboxypeptidase) (Carboxypeptidase N polypeptide 1) (Carboxypeptidase N small subunit) (Kininase-1) (Lysine carboxypeptidase) (Plasma carboxypeptidase B) (Serum carboxypeptidase N) (SCPN) (CPN) (ACBP)

Abbreviation: Recombinant Human CPN1 protein, partial

Organism: Homo sapiens (Human)

Source: E.coli

Expression Region: 21-418aa

Protein Length: Partial

Tag Info: Tag-Free

Target Protein Sequence: VTFRHHRYDDLVRTLYKVQNECPGITRVYSIGRSVEGRHLYVLEFSDHPGIHEPLEPEVKYVGNMHGNEALGRELMLQLSEFLCEEFRNRNQRIVQLIQDTRIHILPSMNPDGYEVAAAQGPNKPGYLVGRNNANGVDLNRNFPDLNTYIYYNEKYGGPNHHLPLPDNWKSQVEPETRAVIRWMHSFNFVLSANLHGGAVVANYPYDKSFEHRVRGVRRTASTPTPDDKLFQKLAKVYSYAHGWMFQGWNCGDYFPDGITNGASWYSLSKGMQDFNYLHTNCFEITLELSCDKFPPEEELQREWLGNREALIQFLEQVHQGIKGMVLDENYNNLANAVISVSGINHDVTSGDHGDYFRLLLPGIYTVSATAPGYDPETVTVTVGPAEPTLVNFHLKRS

MW: 45.6 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Protects the body from potent vasoactive and inflammatory peptides containing C-terminal Arg or Lys which are released into the circulation.

Reference: "Crystal structure of the human carboxypeptidase N (kininase I) catalytic domain." Keil C., Maskos K., Than M., Hoopes J.T., Huber R., Tan F., Deddish P.A., Erdos E.G., Skidgel R.A., Bode W. J. Mol. Biol. 366: 504-516(2007)

Function:

View full details