Recombinant Human Carbonic anhydrase 2(CA2)

Recombinant Human Carbonic anhydrase 2(CA2)

CSB-EP004370HU
Regular price
€490,95 EUR
Sale price
€490,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Signal Transduction

Uniprot ID: P00918

Gene Names: CA2

Organism: Homo sapiens (Human)

AA Sequence: SHHWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHAFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDFGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFAARGLLPESLDYWTYPGSLTTPPLLECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK

Expression Region: 2-260aa

Sequence Info: Full Length of BC011949

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 45.1 kDa

Alternative Name(s): Carbonate dehydratase II;Carbonic anhydrase C ;CAC;Carbonic anhydrase II ;CA-II

Relevance: Essential for bone resorption and osteoclast differentiation . Reversible hydration of carbon dioxide. Can hydrate cyanamide to urea. Involved in the regulation of fluid secretion into the anterior chamber of the eye. Contributes to intracellular pH regulation in the duodenal upper villous epithelium during proton-coupled peptide absorption. Stimulates the chloride-bicarbonate exchange activity of SLC26A6.3 Publications

Reference: Nucleotide sequence of human liver carbonic anhydrase II cDNA.Montgomery J.C., Venta P.J., Tashian R.E., Hewett-Emmett D.Nucleic Acids Res. 15:4687-4687(1987)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share