Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Cancer-testis antigen 1(CTAG1A)

Recombinant Human Cancer-testis antigen 1(CTAG1A)

SKU:CSB-EP006125HU

Regular price €677,95 EUR
Regular price Sale price €677,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: P78358

Gene Names: CTAG1A

Organism: Homo sapiens (Human)

AA Sequence: MQAEGRGTGGSTGDADGPGGPGIPDGPGGNAGGPGEAGATGGRGPRGAGAARASGPGGGAPRGPHGGAASGLNGCCRCGARGPESRLLEFYLAMPFATPMEAELARRSLAQDAPPLPVPGVLLKEFTVSGNILTIRLTAADHRQLQLSISSCLQQLSLLMWITQCFLPVFLAQPPSGQRR

Expression Region: 1-180aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 10xHis-tagged

MW: 21.5 kDa

Alternative Name(s): Autoimmunogenic cancer/testis antigen NY-ESO-1 Cancer/testis antigen 6.1

Relevance:

Reference: "A testicular antigen aberrantly expressed in human cancers detected by autologous antibody screening." Chen Y.-T., Scanlan M.J., Sahin U., Tuereci O., Gure A.O., Tsang S., Williamson B., Stockert E., Pfreundschuh M., Old L.J. Proc. Natl. Acad. Sci. U.S.A. 94:1914-1918(1997)

Purity: Greater than 85% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details