
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Signal Transduction
Uniprot ID: Q15417
Gene Names: CNN3
Organism: Homo sapiens (Human)
AA Sequence: THFNKGPSYGLSAEVKNKIASKYDHQAEEDLRNWIEEVTGMSIGPNFQLGLKDGIILCELINKLQPGSVKKVNESSLNWPQLENIGNFIKAIQAYGMKPHDIFEANDLFENGNMTQVQTTLVALAGLAKTKGFHTTIDIGVKYAEKQTRRFDEGKLKAGQSVIGLQMGTNKCASQAGMTAYGTRRHLYDPKMQTDKPFDQTTISLQMGTNKGASQAGMLAPGTRRDIYDQKLTLQPVDNSTISLQMGTNKVASQKGMSVYGLGRQVYDPKYCAAPTEPVIHNGSQGTGTNGSEISDSDYQAEYPDEYHGEYQDDYPRDYQYSDQGIDY
Expression Region: 2-329aa
Sequence Info: Partial
Source: E.coli
Tag Info: N-terminal 6xHis-tagged
MW: 40.3 kDa
Alternative Name(s): Calponin, acidic isoform
Relevance: Thin filament-associated protein that is implicated in the regulation and modulation of smooth muscle contraction. It is capable of binding to actin, calmodulin, troponin C and tropomyosin. The interaction of calponin with actin inhibits the actomyosin Mg-ATPase activity.
Reference: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.J. Proteomics 96:253-262(2014)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Human Calponin-2(CNN2)
- Regular price
- €499,95 EUR
- Sale price
- €499,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Calponin-1(CNN1)
- Regular price
- €499,95 EUR
- Sale price
- €499,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Myosin-binding protein C, cardiac-type(MYBPC3),partial
- Regular price
- €499,95 EUR
- Sale price
- €499,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Tropomyosin alpha-3 chain(TPM3)
- Regular price
- €499,95 EUR
- Sale price
- €499,95 EUR
- Regular price
-
- Unit price
- per
Sold out