Recombinant Human C-type lectin domain family 4 member C(CLEC4C),parial (Active)

Recombinant Human C-type lectin domain family 4 member C(CLEC4C),parial (Active)

CSB-EP855470HU
Regular price
€1.454,95 EUR
Sale price
€1.454,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

Size:1mg. Other sizes are also available. Please contact us.

Research Areas:Immunology

Uniprot NO.:Q8WTT0

Uniprot Entry Name:

Gene Names:CLEC4C

Species:Homo sapiens (Human)

Source:E.coli

Expression Region:45-213aa

Sequence:NFMYSKTVKRLSKLREYQQYHPSLTCVMEGKDIEDWSCCPTPWTSFQSSCYFISTGMQSWTKSQKNCSVMGADLVVINTREEQDFIIQNLKRNSSYFLGLSDPGGRRHWQWVDQTPYNENVTFWHSGEPNNLDERCAIINFRSSEEWGWNDIHCHVPQKSICKMKKIYI

Protein Description:Extracellular Domain

Tag Info:N-terminal 6xHis-SUMO-tagged

Mol. Weight:36 kDa

Biological_Activity:Measured by its binding ability in a functional ELISA. Immobilized CLEC4C protein at 1 ?g/ml can bind human CLEC4C antibody, the EC50 of human CLEC4C antibody is 31.43-43.52 ?g/ml.

Purity:Greater than 90% as determined by SDS-PAGE.

Endotoxin:Not test.

Form:Lyophilized powder

Buffer:Lyophilized from 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0

Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Alternative Name/ Alias:Blood dendritic cell antigen 2 ;BDCA-2;C-type lectin superfamily member 7Dendritic lectin; CD303

Relevance:Involved in antigen-capturing. Target ligand into antigen processing and peptide-loading compartments for presentation to T-cells. May mediate potent inhibition of induction of IFN-alpha/beta expression in plasmacytoid dendritic cells. May act as a signaling receptor that activates protein-tyrosine kinases and mobilizes intracellular calcium. Does not se to bind mannose.

PubMed ID:

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

HGNC Database Link:

UniGene Database Link:

KEGG Database Link:

STRING Database Link:

OMIM Database Link:

You may also like

  • Recombinant Human C-type lectin domain family 4 member C(CLEC4C),partial
    Regular price
    €889,95 EUR
    Sale price
    €889,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Mouse C-type lectin domain family 4 member G(Clec4g),partial
    Regular price
    €724,95 EUR
    Sale price
    €724,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human CD44 antigen(CD44),partial,Biotinylated (Active)
    Regular price
    €534,95 EUR
    Sale price
    €534,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human C-type lectin domain family 4 member C(CLEC4C),partial
    Regular price
    €612,95 EUR
    Sale price
    €612,95 EUR
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share