Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Beta-defensin 124(DEFB124)

Recombinant Human Beta-defensin 124(DEFB124)

SKU:CSB-EP836731HU

Regular price €606,95 EUR
Regular price Sale price €606,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: Q8NES8

Gene Names: DEFB124

Organism: Homo sapiens (Human)

AA Sequence: EFKRCWKGQGACQTYCTRQETYMHLCPDASLCCLSYALKPPPVPKHEYE

Expression Region: 23-71aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 21.7 kDa

Alternative Name(s): Beta-defensin 24 ;DEFB-24Defensin, beta 124

Relevance: Has antibacterial activity.Curated

Reference: Discovery of five conserved beta-defensin gene clusters using a computational search strategy.Schutte B.C., Mitros J.P., Bartlett J.A., Walters J.D., Jia H.P., Welsh M.J., Casavant T.L., McCray P.B. Jr.Proc. Natl. Acad. Sci. U.S.A. 99:2129-2133(2002)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details