Gene Bio Systems
Recombinant Human B-cell antigen receptor complex-associated protein beta chain(CD79B)
Recombinant Human B-cell antigen receptor complex-associated protein beta chain(CD79B)
SKU:CSB-CF004958HU
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Homo sapiens (Human)
Uniprot NO.:P40259
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:ARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKDGIIMIQTLLIILFIIVPIFLLLDKDDSKAGMEEDHTYEGLDIDQTATYEDIVTLRTGEVKWSVGEHPGQE
Protein Names:Recommended name: B-cell antigen receptor complex-associated protein beta chain Alternative name(s): B-cell-specific glycoprotein B29 Ig-beta Immunoglobulin-associated B29 protein CD_antigen= CD79b
Gene Names:Name:CD79B Synonyms:B29, IGB
Expression Region:29-229
Sequence Info:full length protein
