
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Metabolism
Uniprot ID: P48047
Gene Names: ATP5O
Organism: Homo sapiens (Human)
AA Sequence: FAKLVRPPVQVYGIEGRYATALYSAASKQNKLEQVEKELLRVAQILKEPKVAASVLNPYVKRSIKVKSLNDITAKERFSPLTTNLINLLAENGRLSNTQGVVSAFSTMMSVHRGEVPCTVTSASPLEEATLSELKTVLKSFLSQGQVLKLEAKTDPSILGGMIVRIGEKYVDMSVKTKIQKLGRAMREIV
Expression Region: 24-213aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal GST-tagged
MW: 47.9 kDa
Alternative Name(s): Oligomycin sensitivity conferral protein ;OSCP
Relevance: Mitochondrial mbrane ATP synthase (F1F0 ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the mbrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F1 - containing the extrambraneous catalytic core and F0 - containing the mbrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F1 is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F0 domain and the peripheric stalk, which acts as a stator to hold the catalytic alpha3beta3 subcomplex and subunit a/ATP6 static relative to the rotary elents.
Reference: "Complete sequencing and characterization of 21,243 full-length human cDNAs."Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Human ATP synthase subunitd, mitochondrial(ATP5H)
- Regular price
- €609,95 EUR
- Sale price
- €609,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human ATP synthase subunit beta, mitochondrial(ATP5B),partial
- Regular price
- €690,95 EUR
- Sale price
- €690,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human ATP synthase subunit delta, mitochondrial(ATP5D)
- Regular price
- €609,95 EUR
- Sale price
- €609,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human ATP synthase subunit alpha, mitochondrial(ATP5A1)
- Regular price
- €609,95 EUR
- Sale price
- €609,95 EUR
- Regular price
-
- Unit price
- per
Sold out