Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human ATP synthase lipid-binding protein, mitochondrial(ATP5G1)

Recombinant Human ATP synthase lipid-binding protein, mitochondrial(ATP5G1)

SKU:CSB-CF002359HU

Regular price €1.209,95 EUR
Regular price Sale price €1.209,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:P05496

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:DIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAM GLFCLMVAFLILFAM

Protein Names:Recommended name: ATP synthase lipid-binding protein, mitochondrial Alternative name(s): ATP synthase proteolipid P1 ATPase protein 9 ATPase subunit c

Gene Names:Name:ATP5G1

Expression Region:62-136

Sequence Info:Full length protein

View full details