Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human AP-1 complex subunit sigma-3(AP1S3)

Recombinant Human AP-1 complex subunit sigma-3(AP1S3)

SKU:CSB-EP001868HU

Regular price €606,95 EUR
Regular price Sale price €606,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: Q96PC3

Gene Names: AP1S3

Organism: Homo sapiens (Human)

AA Sequence: MIHFILLFSRQGKLRLQKWYITLPDKERKKITREIVQIILSRGHRTSSFVDWKELKLVYKRYASLYFCCAIENQDNELLTLEIVHRYVELLDKYFGNTWPFARA

Expression Region: 1-104aa

Sequence Info: Full Length of Isoform 3

Source: E.coli

Tag Info: N-terminal GST-tagged

MW: 39.7 kDa

Alternative Name(s): Adaptor protein complex AP-1 subunit sigma-1C;Adaptor-related protein complex 1 subunit sigma-1C;Clathrin assembly protein complex 1 sigma-1C small chain;Golgi adaptor HA1/AP1 adaptin sigma-1C subunit;Sigma 1C subunit of AP-1 clathrin;Sigma-adaptin 1C;Sigma1C-adaptin

Relevance: Subunit of clathrin-associated adaptor protein complex 1 that plays a role in protein sorting in the late-Golgi/trans-Golgi network (TGN) and/or endosomes. The AP complexes mediate both the recruitment of clathrin to mbranes and the recognition of sorting signals within the cytosolic tails of transmbrane cargo molecules. Involved in TLR3 trafficking .

Reference: AP1S3 mutations are associated with pustular psoriasis and impaired Toll-like receptor 3 trafficking.Setta-Kaffetzi N., Simpson M.A., Navarini A.A., Patel V.M., Lu H.C., Allen M.H., Duckworth M., Bachelez H., Burden A.D., Choon S.E., Griffiths C.E., Kirby B., Kolios A., Seyger M.M., Prins C., Smahi A., Trembath R.C., Fraternali F. , Smith C.H., Barker J.N., Capon F.Am. J. Hum. Genet. 94:790-797(2014)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details