Gene Bio Systems
Recombinant Human Alpha-crystallin B chain(CRYAB)
Recombinant Human Alpha-crystallin B chain(CRYAB)
SKU:CSB-EP006008HU
Couldn't load pickup availability
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Cancer
Uniprot ID: P02511
Gene Names: CRYAB
Organism: Homo sapiens (Human)
AA Sequence: MDIAIHHPWIRRPFFPFHSPSRLFDQFFGEHLLESDLFPTSTSLSPFYLRPPSFLRAPSWFDTGLSEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPADVDPLTITSSLSSDGVLTVNGPRKQVSGPERTIPITREEKPAVTAAPKK
Expression Region: 1-175aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
MW: 36.2 kDa
Alternative Name(s): Alpha(B)-crystallinHeat shock protein beta-5 ;HspB5Renal carcinoma antigen NY-REN-27Rosenthal fiber component
Relevance: May contribute to the transparency and refractive index of the lens. Has chaperone-like activity, preventing aggregation of various proteins under a wide range of stress conditions.
Reference: The primary structure of the B2 chain of human alpha-crystallin.Kramps J.A., de Man B.M., de Jong W.W.FEBS Lett. 74:82-84(1977)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
