Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Alpha-(1,3)-fucosyltransferase(FUT6)

Recombinant Human Alpha-(1,3)-fucosyltransferase(FUT6)

SKU:CSB-CF009080HU

Regular price €1.637,95 EUR
Regular price Sale price €1.637,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:P51993

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDPLGPAKPQWSWRCCLTTLLFQLLMAVCFFSYLRVSQDDPTVYPNGSRFPDSTGTPAHSIPLILLWTWPFNKPIALPRCSEMVPGTADCNITADRKVYPQADAVIVHHREVMYNPSAQLPRSPRRQGQRWIWFSMESPSHCWQLKAMDGYFNLTMSYRSDSDIFTPYGWLEPWSGQPAHPPLNLSAKTELVAWAVSNWGPNSARVRYYQSLQAHLKVDVYGRSHKPLPQGTMMETLSRYKFYLAFENSLHPDYITEKLWRNALEAWAVPVVLGPSRSNYERFLPPDAFIHVDDFQSPKDLARYLQELDKDHARYLSYFRWRETLRPRSFSWALAFCKACWKLQEESRYQTRGIAAWFT

Protein Names:Recommended name: Alpha-(1,3)-fucosyltransferase EC= 2.4.1.65Alternative name(s): Fucosyltransferase 6 Fucosyltransferase VI Short name= Fuc-TVI Short name= FucT-VI Galactoside 3-L-fucosyltransferase

Gene Names:Name:FUT6Synonyms:FCT3A

Expression Region:1-359

Sequence Info:full length protein

View full details