Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human ADP-ribosylation factor-like protein 6-interacting protein 6(ARL6IP6)

Recombinant Human ADP-ribosylation factor-like protein 6-interacting protein 6(ARL6IP6)

SKU:CSB-CF850817HU

Regular price €1.511,95 EUR
Regular price Sale price €1.511,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:Q8N6S5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSFAESGWRSALRRRGPGTPGPVARPSYSSFTQGDSWGEGEVDEEEGCDQVARDLRAEFS AGAWSEPRKRSVLPPDGNGSPVLPDKRNGIFPAAAGSRAQPRRWPVQVLSILCSLLFAIL LAFLLAIAYLIVKELHAENLKNEDDVDTGLLGFWTLLIISLTAGFSCCSFSWTVTYFDSF EPGMFPPTPLSPARFKKLTGHSFHMGYSMAILNGIVAALTVAWCLM

Protein Names:Recommended name: ADP-ribosylation factor-like protein 6-interacting protein 6 Short name= ARL-6-interacting protein 6 Short name= Aip-6 Alternative name(s): Phosphonoformate immuno-associated protein 1

Gene Names:Name:ARL6IP6 Synonyms:PFAAP1

Expression Region:1-226

Sequence Info:full length protein

View full details