Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human ADP-ATP translocase 3(SLC25A6)

Recombinant Human ADP-ATP translocase 3(SLC25A6)

SKU:CSB-CF021520HU

Regular price €1.581,95 EUR
Regular price Sale price €1.581,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:P12236

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:TEQAISFAKDFLAGGIAAAISKTAVAPIERVKLLLQVQHASKQIAADKQYKGIVDCIVRI PKEQGVLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKHTQFWRYFAGNLASGG AAGATSLCFVYPLDFARTRLAADVGKSGTEREFRGLGDCLVKITKSDGIRGLYQGFSVSV QGIIIYRAAYFGVYDTAKGMLPDPKNTHIVVSWMIAQTVTAVAGVVSYPFDTVRRRMMMQ SGRKGADIMYTGTVDCWRKIFRDEGGKAFFKGAWSNVLRGMGGAFVLVLYDELKKVI

Protein Names:Recommended name: ADP/ATP translocase 3 Alternative name(s): ADP,ATP carrier protein 3 ADP,ATP carrier protein, isoform T2 Short name= ANT 2 Adenine nucleotide translocator 3 Short name= ANT 3 Solute carrier family 25 mem

Gene Names:Name:SLC25A6 Synonyms:ANT3 ORF Names:CDABP0051

Expression Region:2-298

Sequence Info:Full length protein

View full details