
>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20170725
Research areas: Neuroscience
Target / Protein: CHRNA1
Biologically active: Not Tested
Expression system: E.coli
Species of origin: Homo sapiens (Human)
Delivery time: 3-7 business days
Uniprot ID: P02708
AA Sequence: SEHETRLVAKLFKDYSSVVRPVEDHRQVVEVTVGLQLIQLINVDEVNQIVTTNVRLKQGDMVDLPRPSCVTLGVPLFSHLQNEQWVDYNLKWNPDDYGGVKKIHIPSEKIWRPDLVLYNNADGDFAIVKFTKVLLQYTGHITWTPPAIFKSYCEIIVTHFPFDEQNCSMKLGTWTYDGSVVAINPESDQPDLSNFMESGEWVIKESRGWKHSVTYSCCPDTPYLDITYHFVMQRL
Tag info: N-terminal 6xHis-Trx-tagged
Expression Region: 21-255aa
Protein length: Extracellular Domain
MW: 44.1 kDa
Alternative Name(s):
Relevance: After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane.
Reference: "The human medulloblastoma cell line TE671 expresses a muscle-like acetylcholine receptor. Cloning of the alpha-subunit cDNA." Schoepfer R., Luther M., Lindstrom J.M. FEBS Lett. 226:235-240(1988)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Human Acetylcholine receptor subunit alpha(CHRNA1),partial
- Regular price
- €499,95 EUR
- Sale price
- €499,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mouse Acetylcholine receptor subunit alpha(Chrna1),partial
- Regular price
- €639,95 EUR
- Sale price
- €639,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mouse Acetylcholine receptor subunit alpha(Chrna1),partial
- Regular price
- €639,95 EUR
- Sale price
- €639,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Torpedo californica Acetylcholine receptor subunit alpha(CHRNA1),partial
- Regular price
- €751,95 EUR
- Sale price
- €751,95 EUR
- Regular price
-
- Unit price
- per
Sold out