Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human 14KDA phosphohistidine phosphatase(PHPT1)

Recombinant Human 14KDA phosphohistidine phosphatase(PHPT1)

SKU:CSB-YP017942HU

Regular price €677,95 EUR
Regular price Sale price €677,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 22-32 working days

Research Topic: Cell Biology

Uniprot ID: Q9NRX4

Gene Names: PHPT1

Organism: Homo sapiens (Human)

AA Sequence: MAVADLALIPDVDIDSDGVFKYVLIRVHSAPRSGAPAAESKEIVRGYKWAEYHADIYDKVSGDMQKQGCDCECLGGGRISHQSQDKKIHVYGYSMAYGPAQHAISTEKIKAKYPDYEVTWANDGY

Expression Region: 1-125aa

Sequence Info: Full Length

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

MW: 15.8 kDa

Alternative Name(s): Phosphohistidine phosphatase 1;Protein janus-A homolog

Relevance: Exhibits phosphohistidine phosphatase activity.

Reference: Identification and characterization of a mammalian 14-KDA phosphohistidine phosphatase.Ek P., Pettersson G., Ek B., Gong F., Li J.-P., Zetterqvist O.Eur. J. Biochem. 269:5016-5023(2002)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details