Skip to product information
1 of 1

Gene Bio Systems

Recombinant Horse Major allergen Equ c 1

Recombinant Horse Major allergen Equ c 1

SKU:CSB-YP839158HO

Regular price €1.121,95 EUR
Regular price Sale price €1.121,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: Yes

Lead time: 3-7 working days

Research Topic: Allergen

Uniprot ID: Q95182

Gene Names: N/A

Organism: Equus caballus (Horse)

AA Sequence: QQEENSDVAIRNFDISKISGEWYSIFLASDVKEKIEENGSMRVFVDVIRALDNSSLYAEYQTKVNGECTEFPMVFDKTEEDGVYSLNYDGYNVFRISEFENDEHIILYLVNFDKDRPFQLFEFYAREPDVSPEIKEEFVKIVQKRGIVKENIIDLTKIDRCFQLRGNGVAQA

Expression Region: 16-187aa

Sequence Info: Full Length of Mature Protein

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

MW: 22.1 kDa

Alternative Name(s): Allergen: Equ c 1

Relevance:

Reference: "Biochemical characterization and surfactant properties of horse allergens."Goubran Botros H., Poncet P., Rabillon J., Fontaine T., Laval J.-M., David B.Eur. J. Biochem. 268:3126-3136(2001)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details