Gene Bio Systems
Recombinant Horse Major allergen Equ c 1
Recombinant Horse Major allergen Equ c 1
SKU:CSB-YP839158HO
Couldn't load pickup availability
>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20170405
Research areas: Allergen
Target / Protein:
Biologically active: Not Tested
Expression system: Yeast
Species of origin: Equus caballus (Horse)
Delivery time: 3-7 business days
Uniprot ID: Q95182
AA Sequence: QQEENSDVAIRNFDISKISGEWYSIFLASDVKEKIEENGSMRVFVDVIRALDNSSLYAEYQTKVNGECTEFPMVFDKTEEDGVYSLNYDGYNVFRISEFENDEHIILYLVNFDKDRPFQLFEFYAREPDVSPEIKEEFVKIVQKRGIVKENIIDLTKIDRCFQLRGNGVAQA
Tag info: N-terminal 6xHis-tagged
Expression Region: 16-187aa
Protein length: Full Length of Mature Protein
MW: 22.1 kDa
Alternative Name(s): Allergen: Equ c 1
Relevance:
Reference: "Biochemical characterization and surfactant properties of horse allergens."Goubran Botros H., Poncet P., Rabillon J., Fontaine T., Laval J.-M., David B.Eur. J. Biochem. 268:3126-3136(2001)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
