Skip to product information
1 of 1

Gene Bio Systems

Recombinant Hordeum vulgare Chlorophyll a-b binding protein 2, chloroplastic(CAB2)

Recombinant Hordeum vulgare Chlorophyll a-b binding protein 2, chloroplastic(CAB2)

SKU:CSB-CF357538HWQ

Regular price €1.512,95 EUR
Regular price Sale price €1.512,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Hordeum vulgare (Barley)

Uniprot NO.:P08963

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:RKTAATKKVGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRE LEVIHGRWAMLGALGCVFPELLARNGVKFGEAVWFKKGSQIFSEGGLQYLGNPSLVHAQS ILAIWACQVVLMGAVEGYRVAGGPLGEVVDPLYPGGSFDPLGLADDAEAFAELKVKEIKN GRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAFATNFVPGK

Protein Names:Recommended name: Chlorophyll a-b binding protein 2, chloroplastic Alternative name(s): LHCII type I CAB-2 Short name= LHCP

Gene Names:Name:CAB2

Expression Region:36-264

Sequence Info:full length protein

View full details