Skip to product information
1 of 1

Gene Bio Systems

Recombinant Holin-like protein CidA 1(cidA1)

Recombinant Holin-like protein CidA 1(cidA1)

SKU:CSB-CF769113BQE

Regular price €1.403,95 EUR
Regular price Sale price €1.403,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bacillus anthracis

Uniprot NO.:Q81Y27

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKWWKLSGQILLLFCFAWTGEWIAKQAHLPIPGSIIGIFLLLISLKFNLVKKEWIQDGAD FLLKELILFFIPSAVAVIRYKDTLSQYGIDLILIIMISTLCVTLVTGLLTELLLKRKGSV Q

Protein Names:Recommended name: Holin-like protein CidA 1

Gene Names:Name:cidA1 Ordered Locus Names:BA_3730, GBAA_3730, BAS3458

Expression Region:1-121

Sequence Info:full length protein

View full details