Skip to product information
1 of 1

Gene Bio Systems

Recombinant His1 virus Putative transmembrane protein ORF25(ORF25)

Recombinant His1 virus Putative transmembrane protein ORF25(ORF25)

SKU:CSB-CF638862HAAR

Regular price €1.375,95 EUR
Regular price Sale price €1.375,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:His1 virus (isolate Australia/Victoria) (His1V) (Haloarcula hispanica virus 1)

Uniprot NO.:Q25BH0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAGIHVVLGLFEGALFTNVNAFLVLMIILSGLIGLFSGYASIGAFGSFVSFTHIASTVDL WIFNSMLYIIMTIVFVVMSLQAWQFIGSNGVNQ

Protein Names:Recommended name: Putative transmembrane protein ORF25

Gene Names:ORF Names:ORF25

Expression Region:1-93

Sequence Info:full length protein

View full details