Skip to product information
1 of 1

Gene Bio Systems

Recombinant Herpetosiphon aurantiacus UPF0060 membrane protein Haur_1798 (Haur_1798)

Recombinant Herpetosiphon aurantiacus UPF0060 membrane protein Haur_1798 (Haur_1798)

SKU:CSB-CF434368HSK

Regular price €1.396,95 EUR
Regular price Sale price €1.396,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785)

Uniprot NO.:A9B7R3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MQVFRAVVLFILAGLAEIAGGYLVWQWLRADRSIWFGVLGAILLVGYGFLPTLQPQVWSF GRVYAAYGGVFIVLSLAWGWLIDHNPPDQPSLVGACLALVGAAIILYWPR

Protein Names:Recommended name: UPF0060 membrane protein Haur_1798

Gene Names:Ordered Locus Names:Haur_1798

Expression Region:1-110

Sequence Info:full length protein

View full details