Gene Bio Systems
Recombinant Heliobacterium modesticaldum UPF0756 membrane protein Helmi_09930 (Helmi_09930)
Recombinant Heliobacterium modesticaldum UPF0756 membrane protein Helmi_09930 (Helmi_09930)
SKU:CSB-CF536196HVD
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Heliobacterium modesticaldum (strain ATCC 51547 / Ice1)
Uniprot NO.:B0TA81
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MRGGTVLLILILLLGVIARSPMTALAAASILALSYLGWGGLLEWIEQNGVDTGLIMLTLA MLAPFATGKVGLREVLLSFASLPGIIAVIGGVLATNLNKRGIDLLSGEPQIIVGMIVGSL LGIVLFGGIPVGPLMAGGLTALILQIYGWLSK
Protein Names:Recommended name: UPF0756 membrane protein Helmi_09930
Gene Names:Ordered Locus Names:Helmi_09930 ORF Names:HM1_0948
Expression Region:1-152
Sequence Info:full length protein
