Skip to product information
1 of 1

Gene Bio Systems

Recombinant Helicobacter pylori Urease subunit alpha(ureA)

Recombinant Helicobacter pylori Urease subunit alpha(ureA)

SKU:CSB-EP320452HUV

Regular price €1.001,95 EUR
Regular price Sale price €1.001,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:100ug. Other sizes are also available. For further information, please contact us.

Research Areas:Others

Uniprot ID:P14916

Gene Names:ureA

Organism:Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori)

AA Sequence:MKLTPKELDKLMLHYAGELAKKRKEKGIKLNYVEAVALISAHIMEEARAGKKTAAELMQEGRTLLKPDDVMDGVASMIHEVGIEAMFPDGTKLVTVHTPIEANGKLVPGELFLKNEDITINEGKKAVSVKVKNVGDRPVQIGSHFHFFEVNRCLDFDREKTFGKRLDIASGTAVRFEPGEEKSVELIDIGGNRRIFGFNALVDRQADNESKKIALHRAKERGFHGAKSDDNYVKTIKE

Expression Region:1-238aa

Sequence Info:Full Length

Source:E.coli

Tag Info:N-terminal 6xHis-tagged

MW:30.5 kDa

Alternative Name(s):Urea amidohydrolase subunit alpha

Relevance:Ammonia produced by ureolysis increases the gastric pH thereby providing an environment permissive for colonization of the stomach.

Reference:Identification of the urease operon in Helicobacter pylori and its control by mRNA decay in response to pH.Akada J.K., Shirai M., Takeuchi H., Tsuda M., Nakazawa T.Mol. Microbiol. 36:1071-1084(2000)

Purity:Greater than 85% as determined by SDS-PAGE.

Form:Liquid or Lyophilized powder

Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:Ammonia produced by ureolysis increases the gastric pH thereby providing an environment permissive for colonization of the stomach.

Involvement in disease:

Subcellular Location:Cytoplasm

Protein Families:Urease gamma subunit family; Urease beta subunit family

Tissue Specificity:

Paythway:

HGNC Database Link:

UniGene Database Link:

KEGG Database Link:https://www.genome.jp/dbget-bin/www_bget?heo:C694_00355

STRING Database Link:https://string-db.org/network/85962.HP0073

OMIM Database Link:

Lead Time Guidance:3-7 business days

View full details