
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: Yes
Lead time: 3-7 working days
Research Topic: Microbiology
Uniprot ID: P43313
Gene Names: dps
Organism: Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori)
AA Sequence: MKTFEILKHLQADAIVLFMKVHNFHWNVKGTDFFNVHKATEEIYEEFADMFDDLAERIVQLGHHPLVTLSEAIKLTRVKEETKTSFHSKDIFKEILEDYKYLEKEFKELSNTAEKEGDKVTVTYADDQLAKLQKSIWMLQAHLA
Expression Region: 1-144aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
MW: 32.9 kDa
Alternative Name(s): Bacterioferritin HP-NAP Neutrophil-activating protein A Short name:NAP A
Relevance: Protects DNA from oxidative damage by sequestering intracellular Fe2+ ion and storing it in the form of Fe3+ oxyhydroxide mineral. One hydrogen peroxide oxidizes two Fe2+ ions, which prevents hydroxyl radical production by the Fenton reaction (By similarity). Required for the survival in the presence of oxidative stress. Dps is also a virulence factor that activates neutrophils, mast cells and monocytes. It binds to neutrophil-glycosphingolipids and to sulfated carbohydrates on mucin. It might have a role in the accumulation of neutrophils and monocytes at the site of infection. Induces superoxide anion generation, adhesion and chemotaxis of neutrophils, through a pertussis toxin-sensitive pathway involving MAP kinases.
Reference: "Identification of four new prokaryotic bacterioferritins, from Helicobacter pylori, Anabaena variabilis, Bacillus subtilis and Treponema pallidum, by analysis of gene sequences."Evans D.J. Jr., Evans D.G., Lampert H.C., Nakano H.Gene 153:123-127(1995)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Helicobacter pylor DNA protection during starvation protein(dps)
- Regular price
- €915,95 EUR
- Sale price
- €915,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Helicobacter pylori Bacterial non-heme ferritin(ftnA)
- Regular price
- €1.008,95 EUR
- Sale price
- €1.008,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Helicobacter pylori 36 kDa antigen (HP_1488)
- Regular price
- €1.444,95 EUR
- Sale price
- €1.444,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Helicobacter pylori Putative peptidyl-prolyl cis-trans isomerase HP_0175(HP-0175) (Active)
- Regular price
- €461,95 EUR
- Sale price
- €461,95 EUR
- Regular price
-
- Unit price
- per
Sold out